|
|
|
|
|
|
|
| Information on 1kek_A_643 |
|
Loop code: 1kek_A_643 PDB: 1kek Chain: A Type: HE alpha-beta |
Loop Start: 643 Loop Length: 32 Sec Struct Nt length: 5 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | VKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQW |
| Sec Struct: | HHHHHTT-GGG--GGGS-TT----S-GGGGT-----SEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FS4IRON/SULFUR CLUSTER | N - 680 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | V - 681 | 1 | 0 |
| FS4IRON/SULFUR CLUSTER | P - 682 | 1 | 0 |
| FS4IRON/SULFUR CLUSTER | W - 684 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|