|
|
|
|
|
|
|
| Information on 1oac_A_638 |
|
Loop code: 1oac_A_638 PDB: 1oac Chain: A Type: EH beta-alpha |
Loop Start: 638 Loop Length: 21 Sec Struct Nt length: 5 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | LWVTRYHPGERFPEGKYPNRSTHDTGLGQY |
| Sec Struct: | EEEEE--TT---TT-S--TT-SS--SHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | T - 641 | 0 | 1 |
| CACALCIUM ION | R - 642 | 0 | 1 |
| CACALCIUM ION | Y - 643 | 0 | 1 |
| CACALCIUM ION | H - 644 | 0 | 1 |
| CACALCIUM ION | E - 647 | 0 | 1 |
| CACALCIUM ION | Q - 666 | 1 | 0 |
| CACALCIUM ION | Y - 667 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|