|
|
|
|
|
|
|
| Information on 1epu_A_432 |
|
Loop code: 1epu_A_432 PDB: 1epu Chain: A Type: HE alpha-beta |
Loop Start: 432 Loop Length: 69 Sec Struct Nt length: 8 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | AEEKWIINDQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQSRWTPYKDIEAAVEDKLDTRHYPFLNGGGKSGPRLIIFVV |
| Sec Struct: | HHHHHHHH--TTS---BS-TTS-----TTSGGGS----S--S------------TGGGT-S-TTTS-BTTS------EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | W - 436 | 1 | 0 |
| MSESELENOMETHIONINE | I - 437 | 1 | 0 |
| MSESELENOMETHIONINE | I - 438 | 0 | 1 |
| MSESELENOMETHIONINE | N - 439 | 0 | 1 |
| MSESELENOMETHIONINE | D - 440 | 0 | 1 |
| MSESELENOMETHIONINE | I - 448 | 0 | 1 |
| MSESELENOMETHIONINE | E - 489 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|