|
|
|
|
|
|
|
| Information on 1jj2_2_35 |
|
Loop code: 1jj2_2_35 PDB: 1jj2 Chain: 2 Type: HE alpha-beta |
Loop Start: 35 Loop Length: 23 Sec Struct Nt length: 9 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | WIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRC |
| Sec Struct: | HHHHHHHHH--SS--GGGG-------SS-B--EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | S - 44 | 0 | 1 |
| MGMAGNESIUM ION | G - 45 | 0 | 1 |
| MGMAGNESIUM ION | I - 46 | 0 | 1 |
| MGMAGNESIUM ION | G - 47 | 0 | 1 |
| MGMAGNESIUM ION | N - 48 | 0 | 1 |
| MGMAGNESIUM ION | D - 49 | 0 | 1 |
| MGMAGNESIUM ION | S - 53 | 0 | 1 |
| MGMAGNESIUM ION | K - 54 | 0 | 1 |
| MGMAGNESIUM ION | D - 66 | 0 | 1 |
| CDCADMIUM ION | C - 71 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|