|
|
|
|
|
|
|
| Information on 1scf_A_50 |
|
Loop code: 1scf_A_50 PDB: 1scf Chain: A Type: HH alpha-alpha |
Loop Start: 50 Loop Length: 11 Sec Struct Nt length: 11 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | VQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVEC |
| Sec Struct: | HHHHHHHHHHHTTS-S--SS--HHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | V - 50 | 1 | 0 |
| MSESELENOMETHIONINE | V - 50 | 1 | 0 |
| CACALCIUM ION | Q - 51 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 51 | 1 | 0 |
| CACALCIUM ION | L - 52 | 1 | 0 |
| MSESELENOMETHIONINE | L - 52 | 1 | 0 |
| MSESELENOMETHIONINE | S - 53 | 1 | 0 |
| MSESELENOMETHIONINE | V - 83 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|