|
|
|
|
|
|
|
| Information on 1q4g_A_296 |
|
Loop code: 1q4g_A_296 PDB: 1q4g Chain: A Type: HH alpha-alpha |
Loop Start: 296 Loop Length: 5 Sec Struct Nt length: 24 Sec Struct Ct length: 22 Structure geometry
|
| Sequence: | PGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIE |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHH-TT--HHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | L - 298 | 1 | 0 |
| GOLGLYCEROL | L - 306 | 1 | 0 |
| GOLGLYCEROL | R - 307 | 1 | 0 |
| GOLGLYCEROL | N - 310 | 1 | 0 |
| GOLGLYCEROL | R - 311 | 1 | 0 |
| GOLGLYCEROL | C - 313 | 1 | 0 |
| GOLGLYCEROL | D - 314 | 1 | 0 |
| Associated ArchDB40 Subclass to 1q4g_A_296 |
| Associated ArchDB95 Subclass to 1q4g_A_296 |
| For any comment or web-related incidence, send an email to the webmaster. |
|