|
|
|
|
|
|
|
| Information on 1hh8_A_158 |
|
Loop code: 1hh8_A_158 PDB: 1hh8 Chain: A Type: HH alpha-alpha |
Loop Start: 158 Loop Length: 19 Sec Struct Nt length: 10 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | KIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVA |
| Sec Struct: | HHHHHHHHHHTT---------TT--B---HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FLCCITRATE ANION | Q - 189 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|