|
|
|
|
|
|
|
| Information on 1izc_A_209 |
|
Loop code: 1izc_A_209 PDB: 1izc Chain: A Type: HH alpha-alpha |
Loop Start: 209 Loop Length: 14 Sec Struct Nt length: 7 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | PGDYMIDAGLDLNGALSGVPHPTFVEAMTKFSTAAQR |
| Sec Struct: | HHHHHHHTT--TT--TTS---HHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PYRPYRUVIC ACID | P - 209 | 1 | 0 |
| MGMAGNESIUM ION | G - 210 | 1 | 0 |
| PYRPYRUVIC ACID | G - 210 | 1 | 0 |
| MGMAGNESIUM ION | D - 211 | 1 | 0 |
| PYRPYRUVIC ACID | D - 211 | 1 | 0 |
| PYRPYRUVIC ACID | Y - 212 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|