|
|
|
|
|
|
|
| Information on 1upa_A_170 |
|
Loop code: 1upa_A_170 PDB: 1upa Chain: A Type: HH alpha-alpha |
Loop Start: 170 Loop Length: 25 Sec Struct Nt length: 4 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | VDLLGSSEGIDTNPPANTPAKPVGVVADGWQKAADQAAALLAE |
| Sec Struct: | HHHHT--TT----------SS------TTHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | P - 191 | 0 | 1 |
| MSESELENOMETHIONINE | V - 195 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|