|
|
|
|
|
|
|
| Information on 1fmj_A_187 |
|
Loop code: 1fmj_A_187 PDB: 1fmj Chain: A Type: HH alpha-alpha |
Loop Start: 187 Loop Length: 9 Sec Struct Nt length: 14 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | PRDVAVSSFHHARLLYLLNKQSNFKDFWEMFH |
| Sec Struct: | HHHHHHHHHHHHHHTT-S-TT--HHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | D - 189 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | V - 192 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | S - 193 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | S - 194 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | H - 196 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | H - 197 | 1 | 0 |
| RTLRETINOL | H - 197 | 1 | 0 |
| RTLRETINOL | L - 201 | 0 | 1 |
| RTLRETINOL | Y - 202 | 0 | 1 |
| RTLRETINOL | L - 203 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|