|
|
|
|
|
|
|
| Information on 1qg8_A_167 |
|
Loop code: 1qg8_A_167 PDB: 1qg8 Chain: A Type: HH alpha-alpha |
Loop Start: 167 Loop Length: 13 Sec Struct Nt length: 10 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | SVLEKVKEKFGSYWDESPAFYRIGDARFFWRV |
| Sec Struct: | HHHHHHHHHHSSSS---GGGSTTHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | R - 188 | 0 | 1 |
| MGMAGNESIUM ION | R - 188 | 0 | 1 |
| GOLGLYCEROL | I - 189 | 0 | 1 |
| MGMAGNESIUM ION | I - 189 | 0 | 1 |
| GOLGLYCEROL | G - 190 | 0 | 1 |
| GOLGLYCEROL | D - 191 | 1 | 0 |
| MGMAGNESIUM ION | D - 191 | 1 | 0 |
| GOLGLYCEROL | A - 192 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|