|
|
|
|
|
|
|
| Information on 1q8f_A_79 |
|
Loop code: 1q8f_A_79 PDB: 1q8f Chain: A Type: HH alpha-alpha |
Loop Start: 79 Loop Length: 21 Sec Struct Nt length: 4 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | DNIHGDTGLDGPVFEPLTRQAESTHAVKYIIDTLMA |
| Sec Struct: | HHHH-TTSS-S-----------SS-HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | N - 80 | 1 | 0 |
| GOLGLYCEROL | I - 81 | 0 | 1 |
| GOLGLYCEROL | H - 82 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|