|
|
|
|
|
|
|
| Information on 1j5x_A_162 |
|
Loop code: 1j5x_A_162 PDB: 1j5x Chain: A Type: HH alpha-alpha |
Loop Start: 162 Loop Length: 4 Sec Struct Nt length: 6 Sec Struct Ct length: 22 Structure geometry
|
| Sequence: | LADKIAGNSTERFSELVGYSPEFFDISWKVIE |
| Sec Struct: | HHHHHHT---HHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | L - 162 | 1 | 0 |
| MSESELENOMETHIONINE | A - 163 | 1 | 0 |
| MSESELENOMETHIONINE | D - 164 | 1 | 0 |
| MSESELENOMETHIONINE | K - 165 | 1 | 0 |
| MSESELENOMETHIONINE | T - 171 | 0 | 1 |
| MSESELENOMETHIONINE | F - 174 | 1 | 0 |
| Associated ArchDB40 Subclass to 1j5x_A_162 |
| Associated ArchDB95 Subclass to 1j5x_A_162 |
| For any comment or web-related incidence, send an email to the webmaster. |
|