|
|
|
|
|
|
|
| Information on 1epu_A_293 |
|
Loop code: 1epu_A_293 PDB: 1epu Chain: A Type: HH alpha-alpha |
Loop Start: 293 Loop Length: 13 Sec Struct Nt length: 18 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | IAVVSQNVTKKLKQFADEKRGIKDLSQLKKPQYQKEL |
| Sec Struct: | HHHHHHHHHHHHHHHHHHT------------HHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | I - 293 | 1 | 0 |
| MSESELENOMETHIONINE | A - 294 | 1 | 0 |
| MSESELENOMETHIONINE | V - 296 | 1 | 0 |
| MSESELENOMETHIONINE | V - 300 | 1 | 0 |
| MSESELENOMETHIONINE | K - 305 | 1 | 0 |
| MSESELENOMETHIONINE | A - 308 | 1 | 0 |
| MSESELENOMETHIONINE | R - 312 | 0 | 1 |
| MSESELENOMETHIONINE | L - 329 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|