|
|
|
|
|
|
|
| Information on 1czs_A_17 |
|
Loop code: 1czs_A_17 PDB: 1czs Chain: A Type: AR beta-beta link |
Loop Start: 17 Loop Length: 27 Sec Struct Nt length: 3 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | ITASSFKKSWWGDYWEPFRARLNAQGRVNAWQ |
| Sec Struct: | EEES---B-TTS-B--GGG-BTT--SSS-SEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PHGPHENYLMERCURY | W - 31 | 0 | 1 |
| PHGPHENYLMERCURY | R - 43 | 0 | 1 |
| PHGPHENYLMERCURY | N - 45 | 0 | 1 |
| PHGPHENYLMERCURY | A - 46 | 0 | 1 |
| PHGPHENYLMERCURY | Q - 48 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|