|
|
|
|
|
|
|
| Information on 1rvx_A_112 |
|
Loop code: 1rvx_A_112 PDB: 1rvx Chain: A Type: AR beta-beta link |
Loop Start: 112 Loop Length: 16 Sec Struct Nt length: 8 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | VSSFERFEIFPKESSWPNHNTNGVTAACSH |
| Sec Struct: | EEEEEEEESS-TTTS-TTSB----EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SIAO-SIALIC ACID | N - 133 | 0 | 1 |
| SIAO-SIALIC ACID | G - 134 | 0 | 1 |
| SIAO-SIALIC ACID | V - 135 | 0 | 1 |
| GALD-GALACTOSE | T - 136 | 0 | 1 |
| SIAO-SIALIC ACID | T - 136 | 0 | 1 |
| GALD-GALACTOSE | A - 137 | 1 | 0 |
| SIAO-SIALIC ACID | A - 137 | 1 | 0 |
| SIAO-SIALIC ACID | A - 138 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|