|
|
|
|
|
|
|
| Information on 1loe_A_82 |
|
Loop code: 1loe_A_82 PDB: 1loe Chain: A Type: HA beta-beta hairpin |
Loop Start: 82 Loop Length: 28 Sec Struct Nt length: 6 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | GFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFD |
| Sec Struct: | EEEEEE--TT------GGGTTT-S-SS--GGG--EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | G - 99 | 0 | 1 |
| CACALCIUM ION | L - 101 | 0 | 1 |
| CACALCIUM ION | E - 119 | 1 | 0 |
| MNMANGANESE (II) ION | E - 119 | 1 | 0 |
| CACALCIUM ION | D - 121 | 1 | 0 |
| MNMANGANESE (II) ION | D - 121 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|