|
|
|
|
|
|
|
| Information on 1fx5_A_88 |
|
Loop code: 1fx5_A_88 PDB: 1fx5 Chain: A Type: HA beta-beta hairpin |
Loop Start: 88 Loop Length: 27 Sec Struct Nt length: 7 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | GLTFFLAPPDSPLRRAGGYFGLFNDTKCDSSYQTVAVEFD |
| Sec Struct: | EEEEEEE-TT----B-GGGTTTBSSS---GGG--EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| NAGN-ACETYL-D-GLUCOSAMINE | R - 101 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | R - 102 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | A - 103 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | G - 104 | 0 | 1 |
| CACALCIUM ION | G - 105 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | G - 105 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | Y - 106 | 0 | 1 |
| CACALCIUM ION | F - 107 | 0 | 1 |
| MNMANGANESE (II) ION | F - 107 | 0 | 1 |
| FUCFUCOSE | N - 111 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | N - 111 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|