|
|
|
|
|
|
|
| Information on 1n0s_A_2 |
|
Loop code: 1n0s_A_2 PDB: 1n0s Chain: A Type: AR beta-beta link |
Loop Start: 2 Loop Length: 18 Sec Struct Nt length: 4 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | VYHDGACPEVKPVDNFDWSQYHGKWWEVAK |
| Sec Struct: | EEEESS-------S---GGG--EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FLU2-(6-HYDROXY-3-OXO-3H-XANTHEN-9-YL)-BENZOIC ACID | Y - 22 | 0 | 1 |
| FLU2-(6-HYDROXY-3-OXO-3H-XANTHEN-9-YL)-BENZOIC ACID | E - 28 | 1 | 0 |
| FLU2-(6-HYDROXY-3-OXO-3H-XANTHEN-9-YL)-BENZOIC ACID | K - 31 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|