|
|
|
|
|
|
|
| Information on 1f1x_A_125 |
|
Loop code: 1f1x_A_125 PDB: 1f1x Chain: A Type: AR beta-beta link |
Loop Start: 125 Loop Length: 22 Sec Struct Nt length: 5 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | PYEFFFETTHVERLHMRYDLYSAGELVRLDHFNQVT |
| Sec Struct: | EEEEE--B------TT-TTT--TT---EEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FELHYDRATED FE | H - 155 | 1 | 0 |
| FELHYDRATED FE | F - 156 | 1 | 0 |
| FELHYDRATED FE | N - 157 | 1 | 0 |
| Associated ArchDB95 Subclass to 1f1x_A_125 |
| For any comment or web-related incidence, send an email to the webmaster. |
|