|
|
|
|
|
|
|
| Information on 2msb_A_169 |
|
Loop code: 2msb_A_169 PDB: 2msb Chain: A Type: AR beta-beta link |
Loop Start: 169 Loop Length: 24 Sec Struct Nt length: 2 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | MYVTGGRLTYSNWKKDEPNDHGSGEDCVTI |
| Sec Struct: | EETTSSB--S--B-TT-----TT---EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | E - 185 | 0 | 1 |
| CACALCIUM ION | P - 186 | 0 | 1 |
| CACALCIUM ION | N - 187 | 0 | 1 |
| CACALCIUM ION | D - 188 | 0 | 1 |
| CACALCIUM ION | H - 189 | 0 | 1 |
| CACALCIUM ION | G - 192 | 0 | 1 |
| CACALCIUM ION | E - 193 | 0 | 1 |
| CACALCIUM ION | D - 194 | 0 | 1 |
| CACALCIUM ION | C - 195 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|