|
|
|
|
|
|
|
| Information on 3kiv_*_1 |
|
Loop code: 3kiv_*_1 PDB: 3kiv Chain: * Type: AR beta-beta link |
Loop Start: 1 Loop Length: 57 Sec Struct Nt length: 2 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | CYHGNGQSYRGTFSTTVTGRTCQSWSSMTPHRHQRTPENYPNDGLTMNYCRNPDADTGPWCF |
| Sec Struct: | EE-TTSTT------BBTTS-BB--TT--SSS--S--TTT-TTTT--TT--B-TT--SS-EEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACA6-AMINOHEXANOIC ACID | R - 32 | 0 | 1 |
| ACA6-AMINOHEXANOIC ACID | H - 33 | 0 | 1 |
| ACA6-AMINOHEXANOIC ACID | Q - 34 | 0 | 1 |
| ACA6-AMINOHEXANOIC ACID | R - 35 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| LBS - LYSINE BINDING SITE | R - 35 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|