|
|
|
|
|
|
|
| Information on 1g0c_A_290 |
|
Loop code: 1g0c_A_290 PDB: 1g0c Chain: A Type: EH beta-alpha |
Loop Start: 290 Loop Length: 13 Sec Struct Nt length: 6 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | MIRLAMYIGENGYATNPEVKDLVYEGIELAFE |
| Sec Struct: | EEEEEE-SSTTSTTT-GGGHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CBICELLOBIOSE | Y - 296 | 0 | 1 |
| CBICELLOBIOSE | E - 299 | 0 | 1 |
| CDCADMIUM ION | D - 310 | 1 | 0 |
| CDCADMIUM ION | L - 311 | 1 | 0 |
| CDCADMIUM ION | E - 314 | 1 | 0 |
| CDCADMIUM ION | L - 318 | 1 | 0 |
| CDCADMIUM ION | E - 321 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|