|
|
|
|
|
|
|
| Information on 1g0c_A_325 |
|
Loop code: 1g0c_A_325 PDB: 1g0c Chain: A Type: EH beta-alpha |
Loop Start: 325 Loop Length: 15 Sec Struct Nt length: 6 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | YVIVDWHVHAPGDPRADVYSGAYDFFEEIADHY |
| Sec Struct: | EEEEEE---SSS-TTSGGGTTHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CBICELLOBIOSE | H - 331 | 0 | 1 |
| CDCADMIUM ION | H - 331 | 0 | 1 |
| CBICELLOBIOSE | H - 333 | 0 | 1 |
| CDCADMIUM ION | H - 333 | 0 | 1 |
| CDCADMIUM ION | Y - 347 | 1 | 0 |
| CDCADMIUM ION | D - 348 | 1 | 0 |
| CDCADMIUM ION | E - 351 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|