|
|
|
|
|
|
|
| Information on 1rv8_A_128 |
|
Loop code: 1rv8_A_128 PDB: 1rv8 Chain: A Type: EH beta-alpha |
Loop Start: 128 Loop Length: 13 Sec Struct Nt length: 6 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | TVEAELGRLAGIKDALLTNPEEARIFMERT |
| Sec Struct: | EEEEEES-------TTS--HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| COCOBALT (II) ION | E - 132 | 0 | 1 |
| COCOBALT (II) ION | L - 136 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|