|
|
|
|
|
|
|
| Information on 1g96_A_21 |
|
Loop code: 1g96_A_21 PDB: 1g96 Chain: A Type: HE alpha-beta |
Loop Start: 21 Loop Length: 15 Sec Struct Nt length: 17 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | EGVRRALDFAVGEYNKASNDMYHSRALQVVRARK |
| Sec Struct: | HHHHHHHHHHHHHHHHH---SS----S-----EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 34 | 1 | 0 |
| GOLGLYCEROL | S - 38 | 0 | 1 |
| GOLGLYCEROL | N - 39 | 0 | 1 |
| GOLGLYCEROL | D - 40 | 0 | 1 |
| GOLGLYCEROL | S - 44 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|