|
|
|
|
|
|
|
| Information on 1n9b_A_144 |
|
Loop code: 1n9b_A_144 PDB: 1n9b Chain: A Type: HE alpha-beta |
Loop Start: 144 Loop Length: 25 Sec Struct Nt length: 11 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | GPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTT |
| Sec Struct: | HHHHHHHHHHHTT--S-B----TTGGG---TT--TTEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MPD2-METHYL-2,4-PENTANEDIOL | F - 151 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | Q - 154 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | I - 155 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|