|
|
|
|
|
|
|
| Information on 1dvi_A_119 |
|
Loop code: 1dvi_A_119 PDB: 1dvi Chain: A Type: HH alpha-alpha |
Loop Start: 119 Loop Length: 10 Sec Struct Nt length: 14 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | ATELMNILNKVVTRHPDLKTDGFGIDTSRSMVAVM |
| Sec Struct: | HHHHHHHHHHHHHH-TTS--S---HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | E - 121 | 1 | 0 |
| CACALCIUM ION | T - 138 | 0 | 1 |
| CACALCIUM ION | D - 139 | 0 | 1 |
| CACALCIUM ION | G - 140 | 0 | 1 |
| CACALCIUM ION | D - 144 | 1 | 0 |
| CACALCIUM ION | R - 147 | 1 | 0 |
| CACALCIUM ION | M - 153 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|