|
|
|
|
|
|
|
| Information on 1csc_*_222 |
|
Loop code: 1csc_*_222 PDB: 1csc Chain: * Type: HH alpha-alpha |
Loop Start: 222 Loop Length: 8 Sec Struct Nt length: 13 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | AQFTELMRLYLTIHSDHEGGNVSAHTSHLVG |
| Sec Struct: | HHHHHHHHHHHHHTS---S-SHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MALMALTOSE | H - 235 | 0 | 1 |
| MALMALTOSE | D - 237 | 0 | 1 |
| MALMALTOSE | H - 238 | 0 | 1 |
| MALMALTOSE | E - 239 | 0 | 1 |
| MALMALTOSE | G - 241 | 0 | 1 |
| MALMALTOSE | N - 242 | 0 | 1 |
| MALMALTOSE | V - 243 | 0 | 1 |
| MALMALTOSE | S - 244 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|