|
|
|
|
|
|
|
| Information on 1mpx_A_279 |
|
Loop code: 1mpx_A_279 PDB: 1mpx Chain: A Type: HH alpha-alpha |
Loop Start: 279 Loop Length: 27 Sec Struct Nt length: 4 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | AFWQEQALDKVARTPLKVPTWLQGLWDQEDWGAIHSYA |
| Sec Struct: | HHHHTT-TTT---S---S---B--TT-S---HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Q - 284 | 0 | 1 |
| MSESELENOMETHIONINE | A - 285 | 0 | 1 |
| CACALCIUM ION | L - 286 | 0 | 1 |
| MSESELENOMETHIONINE | L - 286 | 0 | 1 |
| CACALCIUM ION | D - 287 | 0 | 1 |
| MSESELENOMETHIONINE | D - 287 | 0 | 1 |
| CACALCIUM ION | K - 288 | 0 | 1 |
| MSESELENOMETHIONINE | K - 288 | 0 | 1 |
| CACALCIUM ION | V - 289 | 0 | 1 |
| MSESELENOMETHIONINE | V - 289 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|