Information on SUBCLASS 24.3.1 |
Subclass Accession number: 4339
Subclass: 24.3.1 ![]() Type: AR beta-beta link DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 3.5 (>75 %) 3.5.1 (>75 %) 3.5.1.1 GO : GO:0004067 (>75 %) GO:0016810 (>75 %) GO:0016811 (>75 %) SCOP : 53773 (>75 %) 53774 (>75 %) 53775 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 42.4 +/- 11.6 Average RMSD (Å) : 0.567 +/- 0.115 Consensus geometry
|
Consensus Sequence: | phXpXhXpXHTXppXFDhpXhppLPpVc |
(φψ)-conformation: | bbabbpappbeaapapbaaababbppbb |
Pattern: | [KR] | x | [DY] | [WY] | [FQ] | [NR] | x | [IP] | [AD] | [KR] | x | [H] | [T] | [STV] | [DNR] | [ST] | x | [F] | [D] | [IV] | [KRS] | [GKQ] | [IL] | [NST] | [ES] | [L] | [P] | [KQ] | [V] | [DG] | [I] | [ALV] | [Y] |
Conservation: | 0.232 | -0.994 | -0.506 | 1.057 | -0.893 | -0.169 | -1.235 | -0.638 | -0.835 | 0.229 | -1.011 | 2.449 | 0.942 | -0.956 | -0.732 | -0.199 | -1.235 | 1.444 | 1.444 | 0.201 | -0.677 | -1.011 | -0.038 | -0.509 | -0.437 | 0.440 | 1.946 | -0.014 | 0.440 | -0.220 | 0.440 | -0.900 | 1.946 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1nns_A_186 | 1nns | A | 186 | 218 | KIDYQRTPARKHTSDTPFDVSKLNELPKVGIVY | EEEE-----S--GGGS----TT-S----EEEEE | bbxxabbxaxxbeaabaxbaaaxabbpxbbbbb |
1o7j_A_192 | 1o7j | A | 192 | 224 | RIYYQNRIDKLHTTRSVFDVRGLTSLPKVDILY | EEEE----SS--GGG-----TT-S----EEEEE | bxbxabbxabxbeaaxaxbaaababbpxbbbbx |
4pga_A_196 | 4pga | A | 196 | 228 | KSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAY | EEEE-----S--GGG-S--GGG-S----EEEEE | bxbbabbwaxxbeaaxabbaaababbxxbbbbx |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1o7j_A_192 | 1o7j | A | GOLGLYCEROL | T - 215 |
1o7j_A_192 | 1o7j | A | GOLGLYCEROL | S - 216 |
1o7j_A_192 | 1o7j | A | GOLGLYCEROL | L - 217 |
1o7j_A_192 | 1o7j | A | GOLGLYCEROL | P - 218 |
1o7j_A_192 | 1o7j | A | EDO1,2-ETHANEDIOL | P - 218 |
1o7j_A_192 | 1o7j | A | GOLGLYCEROL | K - 219 |
1o7j_A_192 | 1o7j | A | GOLGLYCEROL | V - 220 |
PDB Site Annotated loops in this subclass |
Loop | PDB | Chain | Site | Residue |
1o7j_A_192 | 1o7j | A | AC3GOL BINDING SITE FOR CHAIN A | S - 216 |
1o7j_A_192 | 1o7j | A | AC3GOL BINDING SITE FOR CHAIN A | L - 217 |
1o7j_A_192 | 1o7j | A | AC3GOL BINDING SITE FOR CHAIN A | K - 219 |
Clusters included in this Subclass |
CLUSTER: AR.23.2 |