Information on SUBCLASS 23.1.1 |
Subclass Accession number: 3632
Subclass: 23.1.1 Type: EH beta-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 6.3 (>50 %) 6.3.4 (>50 %) 6.3.4.4 GO : GO:0000287 (>50 %) GO:0004019 (>75 %) GO:0005525 (>75 %) GO:0016874 (>75 %) GO:0016879 (>75 %) GO:0019001 (>75 %) SCOP : 52539 (>75 %) 52540 (>75 %) 52652 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 71.7 +/- -27.7 Average RMSD (Å) : 0.167 +/- 0.058 Consensus geometry
|
Consensus Sequence: | hEGAphXhLDIDXGTYPhVTSSXXThG |
(φψ)-conformation: | bbpbebaaapaaapppwpbpabpapaa |
Pattern: | [V] | [LM] | [FIV] | [E] | [G] | [A] | [NQ] | [AG] | [AT] | [LM] | [L] | [D] | [I] | [D] | [FH] | [G] | [T] | [Y] | [P] | [FY] | [V] | [T] | [S] | [S] | [CN] | [CT] | [T] | [AV] | [G] | [G] | [V] | [ACF] | [ST] |
Conservation: | -0.092 | -0.598 | -1.379 | 0.551 | 1.195 | -0.092 | -0.847 | -1.105 | -1.235 | -0.603 | -0.092 | 1.195 | -0.092 | 1.195 | -0.774 | 1.195 | 0.551 | 1.838 | 1.838 | 0.462 | -0.092 | 0.551 | -0.092 | -0.092 | -1.287 | -0.869 | 0.551 | -1.366 | 1.195 | 1.195 | -0.092 | -1.879 | -0.832 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1iwe_A_250 | 1iwe | A | 250 | 282 | VLVEGANAALLDIDFGTYPFVTSSNCTVGGVCT | EEEE--S-GGG-TTTSSTTSS-SS--STHHHHH | bbbxxbebaaapaaaxapwxbxabxaxaaaaaa |
1p9b_A_226 | 1p9b | A | 226 | 258 | VLIEGANAAMLDIDFGTYPYVTSSCTTVGGVFS | EEEE--S-GGG-TTTSSTTSS-SS--SHHHHHH | bbbxxbebaaapaaaxxpwxbxabxabaaaaaa |
1qf5_A_218 | 1qf5 | A | 218 | 250 | VMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVAT | EEEE--S-GGG-TTTSSTTSS-SS--STHHHHH | bbbbxbebaaapaaaxxpwxbxabxaxaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
PDB Site Annotated loops in this subclass |
Clusters included in this Subclass |
CLUSTER: EH.23.1 |