Information on SUBCLASS 12.11.1 |
Subclass Accession number: 5146
Subclass: 12.11.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 3.1 (>75 %) 3.1.1 (>75 %) 3.1.1.7 GO : GO:0004091 (>75 %) GO:0004104 (>75 %) GO:0016788 (>75 %) GO:0016789 (>75 %) SCOP : 53473 (>75 %) 53474 (>75 %) 53475 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 75.8 +/- -36.2 Average RMSD (Å) : 0.400 +/- 0.100 Consensus geometry
|
Consensus Sequence: | GFLALXGpXEAPGNhG |
(φψ)-conformation: | aapbbpgpaabaelaa |
Pattern: | [G] | [AT] | [FL] | [G] | [F] | [L] | [A] | [L] | [HP] | [G] | [NS] | [PQR] | [E] | [A] | [P] | [G] | [N] | [MV] | [G] | [L] | [FL] | [D] | [Q] | [QR] | [LM] | [A] | [L] | [Q] | [W] | [V] | [HQ] | [DEK] | [N] |
Conservation: | 0.810 | -1.195 | -0.993 | 0.810 | 0.810 | -0.252 | -0.252 | -0.252 | -0.914 | 0.810 | -0.821 | -1.609 | 0.279 | -0.252 | 1.341 | 0.810 | 0.810 | -0.932 | 0.810 | -0.252 | -1.084 | 0.810 | 0.279 | -0.775 | -0.672 | -0.252 | -0.252 | 0.279 | 3.464 | -0.252 | -0.718 | -1.196 | 0.810 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ea5_A_151 | 1ea5 | A | 151 | 183 | GAFGFLALHGSQEAPGNVGLLDQRMALQWVHDN | HHHHH---TT-SSS-S-HHHHHHHHHHHHHHHH | eaaaapbbpgxaabaevaaaaaaaaaaaaaaaa |
1n5m_A_154 | 1n5m | A | 154 | 186 | GTFGFLALPGSREAPGNVGLLDQRLALQWVQEN | HHHHH---TT-SS--S-HHHHHHHHHHHHHHHH | eaaaaxbbpgxaabaelaaaaaaaaaaaaaaaa |
1p0i_A_149 | 1p0i | A | 149 | 181 | GALGFLALPGNPEAPGNMGLFDQQLALQWVQKN | HHHHH---TT-TTS-S-HHHHHHHHHHHHHHHH | eaaaapbbpgxaabweUaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1n5m_A_154 | 1n5m | A | IODIODIDE ION | P - 162 |
1n5m_A_154 | 1n5m | A | IODIODIDE ION | E - 185 |
Clusters included in this Subclass |
CLUSTER: HH.11.46 |