Information on SUBCLASS 4.45.1 |
Subclass Accession number: 4856
Subclass: 4.45.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 1.1 (>75 %) 1.1.1 (>75 %) 1.1.1.27 GO : GO:0004457 (>75 %) GO:0004459 (>75 %) GO:0016614 (>75 %) GO:0016616 (>75 %) SCOP : 56326 (>75 %) 56327 (>75 %) 56328 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 45.9 +/- 16.5 Average RMSD (Å) : 0.233 +/- 0.058 Consensus geometry
|
Consensus Sequence: | XKGhTphh |
(φψ)-conformation: | aagbbNaa |
Pattern: | [EK] | [AER] | [IV] | [FH] | [KV] | x | [V] | x | [DE] | [AS] | [A] | [Y] | [EQ] | [IV] | [I] | [EK] | [KL] | [K] | [G] | [AY] | [T] | [NSY] | [WY] | [AG] | [I] | [AG] | [LM] | [GS] | [LV] | [A] | [DR] | [LV] | [AIT] | [ER] | [AS] | [IM] | [LM] |
Conservation: | -0.023 | -1.317 | 0.309 | 0.048 | -1.175 | -1.468 | 0.646 | -1.572 | 0.653 | -0.365 | 0.646 | 2.684 | 0.314 | 0.309 | 0.646 | -0.023 | -1.235 | 1.325 | 2.004 | -0.772 | 1.325 | -1.241 | 1.804 | -0.420 | 0.646 | -0.300 | 0.113 | -0.420 | -0.365 | 0.646 | -0.833 | -0.365 | -1.392 | -0.360 | -0.365 | -0.209 | 0.107 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1i0z_A_228 | 1i0z | A | 228 | 264 | KEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESML | HHHHHHHHHHHHHHHHHHSS--HHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaavbbNaaaaaaaaaaaaaaa |
1ldn_A_222 | 1ldn | A | 227 | 263 | ERIFVNVRDAAYQIIEKKGATYYGIAMGLARVTRAIL | HHHHHHHHHHHHHHHHHHS---HHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaavbxNaaaaaaaaaaaaaaa |
9ldt_A_226 | 9ldt | A | 226 | 262 | KAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIM | HHHHHHHHHHHHHHHHHHSS--HHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaagbbNaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.5.119 |