Logo
Information on SUBCLASS 9.6.1
Subclass Accession number: 2003
Subclass: 9.6.1 PSSM
Type: AR beta-beta link
DB: ArchDB40

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 1.14 (>75 %)  1.14.13 (>75 %)  1.14.13.39
GO : GO:0004175 (>50 %)  GO:0004252 (>50 %)  GO:0004497 (>75 %)  GO:0004517 (>75 %)  GO:0005489 (>75 %)  GO:0005506 (>75 %)  GO:0005515 (>75 %)  GO:0005516 (>75 %)  GO:0005529 (>75 %)  GO:0008233 (>50 %)  GO:0008236 (>50 %)  GO:0010181 (>75 %)  GO:0016705 (>75 %)  GO:0016709 (>75 %)  GO:0020037 (>75 %)  GO:0030246 (>75 %)  GO:0046906 (>75 %)  GO:0046914 (>75 %)  GO:0048037 (>75 %)  GO:0050662 (>75 %)  
SCOP : 49898 (>75 %)  49899 (>75 %)  49900 (>75 %)  53849 (>75 %)  53850 (>75 %)  53888 (>75 %)  56511 (>75 %)  56512 (>75 %)  56513 (>75 %)  
 Number of loops: 3

Average sequence ID (%) : 64.4 +/- -13.3
Average RMSD (Å) : 0.233 +/- 0.058

Consensus geometry
d (Å): 17 delta (°): 90-135 theta (°): 45-90 rho (°): 90-135
Consensus Sequence: KPVpphppCHLAX
(φψ)-conformation: bpaaaaaabbabb
Pattern: [R][K][P][V][DT][EK][AFY][KR][DS][C][H][L][A][MQR][AV]
Conservation:0.3560.3561.238-0.084-0.822-0.499-1.112-0.299-0.6942.1191.678-0.084-0.084-1.112-0.958
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1cb6_A_12361cb6   A12361250RKPVDKFKDCHLARVEEEGGGTTTS-SEEEbbxaaaaaabbabxx
1cb6_A_15801cb6   A15801594RKPVTEARSCHLAMAEEEGGGGGGS-SEEEbbpaaaaaabbabxb
1ryo_A_2321ryo   A232246RKPVDEYKDCHLAQVEEEGGGGGGS-SEEEbbpaaaaaabbabbb
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1ryo_A_2321ryo   A     OXLOXALATE ION V - 246
1ryo_A_2321ryo   A     FEFE (III) ION V - 246

Clusters included in this Subclass
CLUSTER: AR.8.24