Information on SUBCLASS 1.1.65 |
Subclass Accession number: 4412
Subclass: 1.1.65 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation GO : GO:0016798 (>75 %) |
Number of loops: 2 Average sequence ID (%) : 15.6 +/- 0.0 Average RMSD (Å) : 0.700 +/- 0.000 Consensus geometry
|
Consensus Sequence: | XppXX |
(φψ)-conformation: | aapaa |
Pattern: | x | [LV] | [D] | [AT] | [L] | [AM] | [LT] | [LM] | [SY] | x | [NS] | [SY] | [PT] | x | [RY] | [AK] | [ES] | [EY] | [F] | [ES] | [AG] | [E] | [IL] | [EQ] | [RT] | x | [EL] | [HL] | [MW] | [AI] | [NR] | [D] |
Conservation: | -1.144 | -0.088 | 2.377 | -0.264 | 0.968 | -0.616 | -0.616 | 0.440 | -0.616 | -0.792 | 0.264 | -0.616 | -0.088 | -0.968 | -0.440 | -0.616 | -0.264 | -0.440 | 2.377 | -0.264 | -0.088 | 1.673 | 0.264 | 0.616 | -0.440 | -0.792 | -1.321 | -0.792 | 0.616 | -0.792 | 0.088 | 2.377 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1dl2_A_84 | 1dl2 | A | 87 | 118 | SVDTLMLMYNSSTLYKSEFEAEIQRSEHWIND | HHHHHHHHHHH-SSSHHHHHHHHHHHHHHHHH | aaaaaaaaaaaxaaaaaaaaaaaaaaaaaaaa |
1qus_A_174 | 1qus | A | 174 | 205 | ILDALATLSFNYPRRAEYFSGELETFLLMARD | HHHHHHHHHHS-GGGHHHHHHHHHHHHHHHHH | aaaaaaaaaaabaaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1dl2_A_84 | 1dl2 | A | NAGN-ACETYL-D-GLUCOSAMINE | L - 93 |
1dl2_A_84 | 1dl2 | A | NAGN-ACETYL-D-GLUCOSAMINE | N - 96 |
1dl2_A_84 | 1dl2 | A | NAGN-ACETYL-D-GLUCOSAMINE | S - 97 |
1dl2_A_84 | 1dl2 | A | NAGN-ACETYL-D-GLUCOSAMINE | N - 117 |
1qus_A_174 | 1qus | A | EDO1,2-ETHANEDIOL | R - 188 |
1qus_A_174 | 1qus | A | BCNBICINE | Y - 191 |
1qus_A_174 | 1qus | A | EDO1,2-ETHANEDIOL | Y - 191 |
1qus_A_174 | 1qus | A | EDO1,2-ETHANEDIOL | F - 192 |
Clusters included in this Subclass |
CLUSTER: HH.4.326 |