Information on SUBCLASS 10.16.1 |
Subclass Accession number: 5113
Subclass: 10.16.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 3.1 (>75 %) 3.1.26 (>75 %) 3.1.26.4 GO : GO:0003676 (>75 %) GO:0003723 (>75 %) GO:0004518 (>75 %) GO:0004519 (>75 %) GO:0004540 (>75 %) GO:0005549 (>75 %) GO:0016788 (>75 %) GO:0030145 (>75 %) SCOP : 47472 (>75 %) 47565 (>75 %) 47566 (>75 %) 53066 (>75 %) 53098 (>75 %) 53099 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 17.2 +/- 14.5 Average RMSD (Å) : 0.933 +/- 0.115 Consensus geometry
|
Consensus Sequence: | XhXXhcXphphpXX |
(φψ)-conformation: | aalabpaalpppaa |
Pattern: | [PQR] | [DES] | [ILT] | [GMT] | [C] | [AY] | [IMT] | [KMY] | [C] | [LV] | x | x | [AKM] | [AFL] | [GNS] | [LMT] | [LV] | [DN] | [DKP] | [EK] | [AG] | [EN] | [FLV] | [DHN] | x | [DGP] | x | [AM] | [LM] | [AEG] | x |
Conservation: | -0.376 | -0.048 | -0.376 | -0.868 | 3.340 | 0.172 | -0.431 | -0.595 | 3.340 | 0.208 | -0.457 | -0.868 | -0.649 | -0.649 | -0.103 | -0.321 | 0.212 | 0.744 | -0.431 | 0.476 | 0.408 | 0.459 | -0.321 | 0.116 | -0.485 | -0.485 | -0.923 | -0.175 | 0.494 | -0.595 | -0.813 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1dqe_A_46 | 1dqe | A | 46 | 76 | RETGCAIMCLSTKLNMLDPEGNLHHGNAMEF | HHHHHHHHHHHHHTT-B-TTSSB-HHHHHHH | aaaaaaaaaaaaaalabxaavxxxaaaaaaa |
1ooh_A_42 | 1ooh | A | 42 | 72 | QDLMCYTKCVSLMAGTVNKKGEFNAPKALAQ | HHHHHHHHHHHHHHTSB-TT--B-HHHHHHH | aaaaaaaaaaaaaavabxaavxxbaaaaaaa |
1r5r_A_43 | 1r5r | A | 43 | 73 | PSITCYMYCLLEAFSLVDDEANVDEDIMLGL | HHHHHHHHHHHHHTTSB-TT--B-HHHHHHH | aaaaaaaaaaaaaalabbaalxxxaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.10.74 |