ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 12.2.1

Subclass Accession number: 6011
Subclass: 12.2.1

Type: HE alpha-beta
DB: ArchDB95

Image coordinates:

Consensus coordinates:

Conserved Annotation
EC : 3.4 (>75 %)  3.4.23 (>75 %)
GO : GO:0004175 (>50 %)  GO:0004190 (>50 %)  GO:0005509 (>75 %)  GO:0008233 (>50 %)  GO:0016298 (>75 %)  GO:0016788 (>75 %)  GO:0016789 (>75 %)
SCOP : 48618 (>75 %)  48619 (>75 %)  48623 (>75 %)  50629 (>75 %)  50630 (>75 %)  50646 (>75 %)

Number of loops: 3

Average sequence ID (%) : 74.4 +/- -32.8
Average RMSD (Å) : 0.467 +/- 0.058

Consensus geometry

d (Å): 19

delta (°): 90-135

theta (°): 135-180

rho (°): 0-45

Consensus Sequence:	cKhTDCcXKpXpYpYp
(φψ)-conformation:	aapaabbaaappbpbb

Pattern:	[A]	[T]	[D]	[R]	[C]	[C]	[F]	[V]	[H]	[DK]	[C]	[C]	[Y]	[GK]	[K]	[AL]	[T]	[D]	[C]	[DN]	[HPS]	[K]	[KT]	[DV]	[RS]	[Y]	[ST]	[Y]	[KS]	[EW]
Conservation:	-0.349	0.027	0.403	0.027	1.531	1.531	0.403	-0.349	1.155	-1.013	1.531	1.531	0.779	-1.200	0.027	-1.284	0.027	0.403	1.531	-0.523	-1.393	0.027	-1.084	-1.446	-1.178	0.779	-0.828	0.779	-1.017	-0.831

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1mc2_A_1040	1mc2	A	1040	1069	ATDRCCFVHKCCYKKLTDCDSKKDRYSYKW	HHHHHHHHHHHHHTT-SSS-TTT----EEE	aaaaaaaaaaaaaaaxaabbaaaxxbxbbb
1pp2_L_40	1pp2	L	40	69	ATDRCCFVHDCCYGKATDCNPKTVSYTYSE	HHHHHHHHHHHHHTT--SS-TTT---EEEE	aaaaaaaaaaaaaaabaabxaaapbbbbbb
1s8i_A_40	1s8i	A	40	69	ATDRCCFVHKCCYKKLTDCNHKTDRYSYSW	HHHHHHHHHHHHHHT--SS-TTT----EEE	aaaaaaaaaaaaaaaxaabbaaaxxbxbbx

Clusters included in this Subclass