ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 8.11.1

Subclass Accession number: 8724
Subclass: 8.11.1

Type: HE alpha-beta
DB: ArchDB-EC

Image coordinates:

Consensus coordinates:

Number of loops: 3

Average sequence ID (%) : 45.2 +/- 9.5
Average RMSD (Å) : 0.567 +/- 0.058

Consensus geometry

d (Å): 21

delta (°): 90-135

theta (°): 135-180

rho (°): 45-90

Consensus Sequence:	pXGCXXKXXXYp
(φψ)-conformation:	aalpbaaappbb

Pattern:	[AE]	[ILT]	[D]	[RW]	[C]	[C]	x	[GIT]	[HQ]	[D]	[CD]	[C]	[Y]	[KST]	[DR]	[AL]	[E]	[EK]	[AKR]	[G]	[C]	[GS]	[PT]	[K]	[FMT]	x	[ARS]	[Y]	[DKS]	[FWY]	[QSY]
Conservation:	-0.675	-0.791	0.806	-0.561	1.858	1.858	-1.102	-1.258	0.005	0.806	-0.301	1.858	1.157	-0.752	-0.658	-0.732	0.456	-0.207	-0.752	0.806	1.858	-0.455	-0.291	0.456	-0.907	-1.180	-0.868	1.157	-0.791	0.105	-0.907

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1le6_A_38	1le6	A	38	68	AIDWCCHGHDCCYTRAEEAGCSPKTERYSWQ	HHHHHHHHHHHHHHHHHHTT--TTT----EE	aaaaaaaaaaaaaaaaaaavxbaaaxxbxbb
1n28_A_39	1n28	A	39	69	ATDRCCVTQDCCYKRLEKRGCGTKFLSYKFS	HHHHHHHHHHHHHHHHHHTT---SS----EE	aaaaaaaaaaaaaaaaaaavxbaaaxxbbbb
2not_A_40	2not	A	40	70	ELDRCCKIHDDCYSDAEKKGCSPKMSAYDYY	HHHHHHHHHHHHHHHHHHTT--TTT----EE	aaaaaaaaaaaaaaaaaaavxxaaaxxxbbb

PDB ligands within a cut-off distance of 6 Å in this subclass

PDB Site Annotated loops in this subclass

Loop	PDB	Chain	Site	Residue
2not_A_40	2not	A	S1NULL	H - 48

Clusters included in this Subclass