Information on SUBCLASS 4.39.1 |
Subclass Accession number: 9088
Subclass: 4.39.1 Type: HH alpha-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 2 Average sequence ID (%) : 37.5 +/- 0.0 Average RMSD (Å) : 0.300 +/- 0.000 Consensus geometry
|
Consensus Sequence: | EKXpLpEp |
(φψ)-conformation: | aa_bbpaa |
Pattern: | [L] | [F] | [D] | [FY] | [L] | [AT] | [E] | [K] | x | [ST] | [L] | [ST] | [E] | [EK] | [E] | [AT] | [RT] | [EK] | [FI] | [LM] | [KR] | [AQ] | [IL] | [L] | [EN] | [GV] | [IV] | [CY] | [AY] | [L] | [H] | [KS] |
Conservation: | 0.321 | 1.628 | 1.628 | 0.811 | 0.321 | -0.821 | 0.974 | 0.974 | -1.474 | -0.495 | 0.321 | -0.495 | 0.974 | -0.332 | 0.974 | -0.821 | -0.985 | -0.332 | -0.658 | -0.168 | -0.005 | -1.148 | -0.332 | 0.321 | -0.495 | -1.638 | -0.005 | -0.332 | -1.148 | 0.321 | 2.934 | -0.821 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1jks_A_101 | 1jks | A | 101 | 132 | LFDFLAEKESLTEEEATEFLKQILNGVYYLHS | HHHHHHHHSS--HHHHHHHHHHHHHHHHHHHH | aaaaaaaaGbbxaaaaaaaaaaaaaaaaaaaa |
1phk_*_111 | 1phk | - | 111 | 142 | LFDYLTEKVTLSEKETRKIMRALLEVICALHK | HHHHHHHHSS--HHHHHHHHHHHHHHHHHHHH | aaaaaaaagbbxaaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1phk_*_111 | 1phk | * | ATPADENOSINE-5'-TRIPHOSPHATE | D - 113 |
Clusters included in this Subclass |
CLUSTER: HH.5.161 |