Information on SUBCLASS 6.17.1 |
Subclass Accession number: 9146
Subclass: 6.17.1 Type: HH alpha-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 66.7 +/- -18.3 Average RMSD (Å) : 0.233 +/- 0.058 Consensus geometry
|
Consensus Sequence: | AYXXhAGEAA |
(φψ)-conformation: | aalpppSbaa |
Pattern: | [QT] | [MT] | [SY] | [R] | [W] | [AS] | [A] | [M] | [Q] | [I] | [AG] | [M] | [S] | [FM] | [I] | [CS] | [A] | [Y] | [AK] | x | [AC] | [A] | [G] | [E] | [A] | [A] | [TV] | [AGS] | [D] | [FL] | [AS] | [FY] | [A] | [AS] |
Conservation: | -0.924 | -0.924 | -1.161 | 0.623 | 3.782 | -0.674 | 0.097 | 0.623 | 0.623 | 0.097 | -0.590 | 0.623 | 0.097 | -0.486 | 0.097 | -0.710 | 0.097 | 1.676 | -1.020 | -1.424 | -0.452 | 0.097 | 1.150 | 0.623 | 0.097 | 0.097 | -0.837 | -1.073 | 1.150 | -0.590 | -0.677 | 0.473 | 0.097 | -0.677 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1e6v_A_223 | 1e6v | A | 225 | 258 | TMYRWAAMQIAMSFICAYKIAAGEAAVSDFAFAS | HHHHHHHHHHHHHHHHHHT--SS-TTHHHHHHHH | aaaaaaaaaaaaaaaaaalxxxSbaaaaaaaaaa |
1e6y_A_1236 | 1e6y | A | 1236 | 1269 | QTSRWAAMQIGMSFISAYAMCAGEAAVADLSFAA | HHHHHHHHHHHHHHHHHTT--TT-HHHHHHHHHH | aaaaaaaaaaaaaaaaaalxxxSbaaaaaaaaaa |
1hbn_A_222 | 1hbn | A | 222 | 255 | TTSRWSAMQIGMSMISAYKQAAGEAATGDFAYAA | HHHHHHHHHHHHHHHHHHT--TT-HHHHHHHHHH | aaaaaaaaaaaaaaaaaavxpxSbaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
PDB Site Annotated loops in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.7.72 |