|
|
|
|
|
|
|
| Information on 1fvg_A_128 |
|
Loop code: 1fvg_A_128 PDB: 1fvg Chain: A Type: HE alpha-beta |
Loop Start: 128 Loop Length: 19 Sec Struct Nt length: 10 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | FEELLKVFWENHDPTQGRQGNDHGSQYRSAI |
| Sec Struct: | HHHHHHHHHHTS-TT---BTTB-SGGG--EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | F - 128 | 1 | 0 |
| MSESELENOMETHIONINE | V - 134 | 1 | 0 |
| MSESELENOMETHIONINE | F - 135 | 1 | 0 |
| MSESELENOMETHIONINE | W - 136 | 0 | 1 |
| MSESELENOMETHIONINE | E - 137 | 0 | 1 |
| MSESELENOMETHIONINE | N - 138 | 0 | 1 |
| MSESELENOMETHIONINE | H - 139 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 143 | 0 | 1 |
| MSESELENOMETHIONINE | G - 144 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|