Information on 1qh4_A_53 |
Loop code: 1qh4_A_53 PDB: 1qh4 Chain: A Type: HH alpha-alpha |
Loop Start: 53 Loop Length: 18 Sec Struct Nt length: 10 Sec Struct Ct length: 4 Structure geometry
|
Sequence: | LDDVIQTGVDNPGHPFIMTVGCVAGDEESYEV |
Sec Struct: | HHHHHHHHHH----SSS-B-----SSTTHHHH |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
ACTACETATE ION | M - 70 | 0 | 1 |
ACTACETATE ION | T - 71 | 0 | 1 |
ACTACETATE ION | V - 72 | 0 | 1 |
ACTACETATE ION | G - 73 | 0 | 1 |
Associated ArchDB-KI Subclass to 1qh4_A_53 |