|
|
|
|
|
|
|
| Information on 1gx5_A_459 |
|
Loop code: 1gx5_A_459 PDB: 1gx5 Chain: A Type: HH alpha-alpha |
Loop Start: 459 Loop Length: 11 Sec Struct Nt length: 9 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | LPQIIERLHGLSAFSLHSYSPGEINRVASCLRKL |
| Sec Struct: | HHHHHHHHH-GGGGT-BS--HHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | I - 463 | 1 | 0 |
| MSESELENOMETHIONINE | L - 466 | 0 | 1 |
| MSESELENOMETHIONINE | H - 467 | 0 | 1 |
| GTPGUANOSINE-5'-TRIPHOSPHATE | A - 486 | 1 | 0 |
| GTPGUANOSINE-5'-TRIPHOSPHATE | L - 489 | 1 | 0 |
| GTPGUANOSINE-5'-TRIPHOSPHATE | R - 490 | 1 | 0 |
| MSESELENOMETHIONINE | K - 491 | 1 | 0 |
| MSESELENOMETHIONINE | L - 492 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|