|
|
|
|
|
|
|
| Information on 1fo3_A_599 |
|
Loop code: 1fo3_A_599 PDB: 1fo3 Chain: A Type: HH alpha-alpha |
Loop Start: 599 Loop Length: 3 Sec Struct Nt length: 13 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | ETVESLFYLYRVTGDRKYQDWGWEILQSFSRF |
| Sec Struct: | HHHHHHHHHHHHH--THHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | E - 599 | 1 | 0 |
| KIFKIFUNENSINE | E - 599 | 1 | 0 |
| CACALCIUM ION | E - 602 | 1 | 0 |
| KIFKIFUNENSINE | E - 602 | 1 | 0 |
| Associated ArchDB40 Subclass to 1fo3_A_599 |
| Associated ArchDB95 Subclass to 1fo3_A_599 |
| Associated ArchDB-EC Subclass to 1fo3_A_599 |
| For any comment or web-related incidence, send an email to the webmaster. |
|