|
|
|
|
|
|
|
| Information on 1kvk_A_179 |
|
Loop code: 1kvk_A_179 PDB: 1kvk Chain: A Type: HH alpha-alpha |
Loop Start: 179 Loop Length: 5 Sec Struct Nt length: 19 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | EEDLKSINKWAYEGERVIHGNPSGVDNSVSTW |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHSS--SHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ATPADENOSINE-5'-TRIPHOSPHATE | E - 193 | 1 | 0 |
| MGMAGNESIUM ION | E - 193 | 1 | 0 |
| ATPADENOSINE-5'-TRIPHOSPHATE | I - 196 | 0 | 1 |
| ATPADENOSINE-5'-TRIPHOSPHATE | H - 197 | 0 | 1 |
| MGMAGNESIUM ION | H - 197 | 0 | 1 |
| ATPADENOSINE-5'-TRIPHOSPHATE | D - 204 | 1 | 0 |
| MGMAGNESIUM ION | D - 204 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|