|
|
|
|
|
|
|
| Information on 1dtd_A_468 |
|
Loop code: 1dtd_A_468 PDB: 1dtd Chain: A Type: HH alpha-alpha |
Loop Start: 468 Loop Length: 53 Sec Struct Nt length: 9 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | PDGYVFSQTKNRMWRKTRSKVSAGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSH |
| Sec Struct: | HHHHHHHHHT-TT--S---B-TTT-S-B---GGG-SSSSTT-TT-BS-TTSTTB--SSTT-SHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GLUGLUTAMIC ACID | R - 482 | 0 | 1 |
| ZNZINC ION | R - 482 | 0 | 1 |
| GLUGLUTAMIC ACID | D - 498 | 0 | 1 |
| GLUGLUTAMIC ACID | N - 500 | 0 | 1 |
| ZNZINC ION | N - 500 | 0 | 1 |
| GLUGLUTAMIC ACID | R - 501 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|