|
|
|
|
|
|
|
| Information on 1pkg_A_877 |
|
Loop code: 1pkg_A_877 PDB: 1pkg Chain: A Type: HH alpha-alpha |
Loop Start: 877 Loop Length: 12 Sec Struct Nt length: 8 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | SKFYKMIKEGFRMLSPEHAPAEMYDIMKTC |
| Sec Struct: | HHHHHHHHTT------TT--HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PTRO-PHOSPHOTYROSINE | Y - 880 | 1 | 0 |
| Associated ArchDB-EC Subclass to 1pkg_A_877 |
| For any comment or web-related incidence, send an email to the webmaster. |
|