|
|
|
|
|
|
|
| Information on 1hfu_A_63 |
|
Loop code: 1hfu_A_63 PDB: 1hfu Chain: A Type: AR beta-beta link |
Loop Start: 63 Loop Length: 25 Sec Struct Nt length: 4 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | IHWHGLFQRGTNWADGADGVNQCPISPGHAFLYKF |
| Sec Struct: | EEEET---TT-GGGS--BTTTB--B-TT-EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CUCOPPER (II) ION | H - 64 | 1 | 0 |
| CUCOPPER (II) ION | H - 66 | 0 | 1 |
| CUCOPPER (II) ION | A - 79 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| T3 - TYPE 3 CU BINDING SITE. | H - 66 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|