|
|
|
|
|
|
|
| Information on 1jy1_A_295 |
|
Loop code: 1jy1_A_295 PDB: 1jy1 Chain: A Type: EH beta-alpha |
Loop Start: 295 Loop Length: 20 Sec Struct Nt length: 4 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | GIWLSPLYPRIADGTHKSGESPTHFKANLISYLT |
| Sec Struct: | EEEE---B-B--TT-------TT-HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | L - 323 | 1 | 0 |
| MSESELENOMETHIONINE | Y - 326 | 1 | 0 |
| MSESELENOMETHIONINE | L - 327 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|